PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P24070_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24176.7 Da    PI: 7.4176
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P24070_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.81.7e-291059251
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           rien   rqvtfskRr g+lKKA+ELSvLCdaeva+i+fss+gklye++s
  GSMUA_Achr1P24070_001 10 RIENAASRQVTFSKRRSGLLKKAYELSVLCDAEVALIVFSSRGKLYEFAS 59
                           8***********************************************86 PP

2K-box60.56.7e-2181171999
                  K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                            ++++++ +l+ e++ + ++i+ L+ ++R+llGedL s+s++eL++Le qLe+sl++i++++ +llle+i +l + e el +en  Lr+
  GSMUA_Achr1P24070_001  81 KATEQSTQLKFEATSMTERIKFLEDQKRKLLGEDLVSCSVEELNELELQLETSLNSIKQTRRRLLLEKIARLNEEETELLKENALLRQ 168
                            5667778899****************************************************************************** PP

                  K-box  97 kle 99 
                            +++
  GSMUA_Achr1P24070_001 169 QVK 171
                            986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.085161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-31374IPR002100Transcription factor, MADS-box
CDDcd002654.47E-41378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.2E-2083170IPR002487Transcription factor, K-box
PROSITE profilePS5129712.02786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MVRGKTQIRR IENAASRQVT FSKRRSGLLK KAYELSVLCD AEVALIVFSS RGKLYEFASS  60
SVQMTIERYM MHTKDAGISK KATEQSTQLK FEATSMTERI KFLEDQKRKL LGEDLVSCSV  120
EELNELELQL ETSLNSIKQT RRRLLLEKIA RLNEEETELL KENALLRQQV KYKSEATPKQ  180
TAIQEADLDD HASQEKNMEV DTELLIGMPG SG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D5e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A5e-20369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J5e-20369268Myocyte-specific enhancer factor 2A
3p57_I5e-20369268Myocyte-specific enhancer factor 2A
3p57_D5e-20369268Myocyte-specific enhancer factor 2A
3p57_C5e-20369268Myocyte-specific enhancer factor 2A
3p57_B5e-20369268Myocyte-specific enhancer factor 2A
3p57_A5e-20369268Myocyte-specific enhancer factor 2A
3kov_J5e-20369268Myocyte-specific enhancer factor 2A
3kov_I5e-20369268Myocyte-specific enhancer factor 2A
3kov_B5e-20369268Myocyte-specific enhancer factor 2A
3kov_A5e-20369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028831e-32AM502883.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM18 (WM18 gene).
GenBankDQ5123301e-32DQ512330.1 Triticum aestivum MADS-box transcription factor TaAGL1 (AGL1) mRNA, complete cds.
GenBankDQ5123351e-32DQ512335.1 Triticum aestivum MADS-box transcription factor TaAGL18 (AGL18) mRNA, complete cds.
GenBankDQ5123401e-32DQ512340.1 Triticum aestivum MADS-box transcription factor TaAGL23 (AGL23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009415401.11e-152PREDICTED: MADS-box transcription factor 50-like
SwissprotQ9XJ601e-68MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0S2L41e-152M0S2L4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P24070_0011e-152(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-52AGAMOUS-like 20